PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AS_1EE692FDC.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 429aa    MW: 47263.8 Da    PI: 6.5682
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AS_1EE692FDC.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Traes_1AS_1EE692FDC.1 14 KGLWSPEEDEKLMNHITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                           678*******************************************97 PP

2Myb_DNA-binding43.95.5e-1467110146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg++ ++E++l+v++++ lG++ W+ Ia+ m+ gRt++++k+ w++
  Traes_1AS_1EE692FDC.1  67 RGAFAQDEEDLIVELHAVLGNR-WSQIAAQMP-GRTDNEIKNLWNS 110
                            79999*****************.*********.*********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.791965IPR017930Myb domain
SuperFamilySSF466895.5E-2912108IPR009057Homeodomain-like
SMARTSM007175.0E-121363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
CDDcd001672.78E-111761No hitNo description
Gene3DG3DSA:1.10.10.606.2E-2465116IPR009057Homeodomain-like
SMARTSM007171.7E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129419.22466116IPR017930Myb domain
PfamPF002493.3E-1267110IPR001005SANT/Myb domain
CDDcd001672.62E-872112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF AQDEEDLIVE LHAVLGNRWS QIAAQMPGRT DNEIKNLWNS SLKKKLRQKG  120
IDPNTHKPLT EADRSGAAPT ISTERTSGSS DVNPSSAGAL GNFGHLLSET AQSSMLLPVY  180
DKKRPETPSL ARPKVPAKEL FLDQLTAGHE SPSSCRSSGP TLYFPFQQQL GYSNECGSGD  240
GANMNSLWFN QNDFSCNTIS TVMPTVSPSA LSTPMGLNLP PDNHHHGGTG IGSAPFYWDG  300
VNPSSSGSTG SSGSNSMGFE PQSTNSILEN SVFPWTDIGV GQEKDTRVQL VEELKWPDLL  360
HGTFAEATTA MQNQSQSLYD DVIKAESQFN MEGICASWFQ NQQPQQQLQA ASDMYDKDLQ  420
RMPLSFEHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN8573100.0JN857310.1 Triticum aestivum cultivar Shannong0431 MYB75 (MYB75) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568972.10.0PREDICTED: transcription factor MYB46-like isoform X1
TrEMBLW4ZV470.0W4ZV47_WHEAT; Uncharacterized protein
STRINGMLOC_59663.60.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-79myb domain protein 61
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]